PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2651_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 326aa    MW: 37309.4 Da    PI: 8.6535
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2651_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.51.7e-42105180277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv gC++dls+ k+yh+rh+vCe+hsk+++v+v+g+eqrfCqqCsrfh lsefD++krsCrrrLa+hnerrrk++
  RrC2651_p2 105 CQVYGCNMDLSSSKDYHKRHRVCETHSKSSMVIVNGIEQRFCQQCSRFHFLSEFDDGKRSCRRRLAGHNERRRKPS 180
                 **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.7E-3499166IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.949102179IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-40103182IPR004333Transcription factor, SBP-box
PfamPF031106.1E-33105178IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDSWSYGTSV FLPNEISLPP SDSFPENPRS MSLGLSNEFD KDDVNGFSAL SSSLLDDDEN  60
LSSSSSSNLS RLDFKLRSFM DYGNYDGRDF TLAAKKPRAS SSPLCQVYGC NMDLSSSKDY  120
HKRHRVCETH SKSSMVIVNG IEQRFCQQCS RFHFLSEFDD GKRSCRRRLA GHNERRRKPS  180
FYFLPGKQQQ NRHKLVPQGN KFPGSFLYRV MDEQDHHHAS RLVSFKDEPT CGAHSHLSAH  240
SQQHVSETPN KSFSITQPNK TFSHSTISYH HMQPPLRTDL GKTKTSTSSS TVDLMQLSLH  300
LRRIEQQQRS FTGDVKQEYN NELYFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-3199178584squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892981e-123AC189298.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028I01, complete sequence.
GenBankAC1894581e-123AC189458.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB073F16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588609.11e-131PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_013588610.11e-131PREDICTED: squamosa promoter-binding-like protein 6
SwissprotQ94JW81e-126SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLA0A078JQD31e-132A0A078JQD3_BRANA; BnaCnng61400D protein
STRINGAT1G69170.11e-124(Arabidopsis thaliana)
STRINGBra004363.1-P1e-124(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92752435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-104SBP family protein